Recombinant Human Flt3-Ligand
Flt3-ligand (FL) is a recently identified hematopoietic cytokine whose activities are mediated by binding to the transmembrane glycoprotein Flt3. Flt3 was first discovered as a member of the class III subfamily of receptor tyrosine kinases (RTK) whose expression among hematopoietic cells was found to be restricted to highly enriched stem/progenitor cell populations. Additionally, class III RTKs include the receptors from SCF, M-CSF and PDGF. Flt3-Ligand binds to cells expressing the tyrosine kinase receptor Flt3. Flt3-Ligand by itself does not stimulate proliferation of early hematopoietic cells, but synergizes with other CSFs and interleukins to induce growth and differentiation. Unlike SCF, Flt3-Ligand exerts no activity on mast cells. Multiple isoforms of Flt3-Ligand have been identified. The predominant biologically active form is anchored to the cell surface as the extracellular domain of a transmembrane protein (209a.a.). The membrane-bound isoform can be proteolytically cleaved to generate a biologically active soluble isoform. Recombinant Human Flt3-Ligand is a soluble 17.6kDa protein consisting of 155 amino acid residues.
|
Product Name |
Recombinant Human Flt3-Ligand (rHuFlt3-Ligand) |
|
Synonyms |
Flt3L, SL Cytokine |
|
Source |
Expressed in E. coli. |
|
Molecular weight |
Approximately 17.6kDa, a single non - glycosylated polypeptide chain containing 155 amino acids. |
|
Accession |
P49771 Thr27 - Ala181 |
|
AA Sequence |
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLK TVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQN FSRCLELQCQPDDSSTLPPPWSPRPLEATAPTA |
|
Purity |
>96% by SDS - PAGE or HPLC. |
|
Biological activity |
Fully biologically active when compared to standard. The ED₅₀ as determined by a cell proliferation assay using human AML5 cells is less than 1.0ng/ml, corresponding to a specific activity of >1.0 × 10⁶IU/mg. |
|
Formulation |
Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, 150mM NaCl, pH7.4 |
|
Endotoxin level |
<0.1EU/μg rHuFlt3 - ligand protein as determined by LAL method. |
Before use this product, please read the direction below carefully.
- This vial must be briefly centrifuged prior to opening to bring the contents to the bottom.
- Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/ml.
For long term storage, the product should be stored ≤-20℃.
36 months, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution;
3 months, -20 to -70℃ under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
New Products
Datasheet
